Product Certification&
    Enterprise Certification

  • Mr.Julian
    Tel: +86 156 1855 4368

  • Mobile:156 1855 4368
  • Tel:+86 156 1855 4368
  • Fax:+86-021-6711 7095
  • Province/state:Shanghai
  • City:Shanghai
  • Street:No.12, Lane 356, Chengnan Road, Chuansha Town, Shanghai
  • MaxCard:
Home > Products >  lower price High quality Glucagon

lower price High quality Glucagon CAS NO.16941-32-5

  • FOB Price: USD: 1.00-1.00 /Kilogram Get Latest Price
  • Min.Order: 1 Kilogram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Available Specifications:

    Industrial Grade (1-10)Kilogram

  • Product Details

Keywords

  • Glucagon
  • 16941-32-5
  • Glucagon

Quick Details

  • ProName: lower price High quality Glucagon
  • CasNo: 16941-32-5
  • Molecular Formula: C153H225N43O49S
  • Appearance: white or almost white powder
  • Application: For scientific research
  • DeliveryTime: Per request
  • PackAge: 1kg/drum, 25kg/drum, 200kg/drum,500kg/...
  • Port: Shanghai
  • ProductionCapacity: 100 Metric Ton/Month
  • Purity: 99%min
  • Storage: Keep it in dry, cool and ventilated pl...
  • Transportation: by sea or by air
  • LimitNum: 1 Kilogram

Superiority

Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceutical, chemical, food, health care, cosmetics and other fields. Customers are now in Asia, Europe, America and other countries and regions.

  Company adheres to market-oriented, technology as the core, customer-centric. R & D headquarters is located in Suzhou, and the core members of R & D team consist of senior postdoctoral fellows and docteral students and masters who are rich in experience. The two factories, respectively located in Shandong and Henan, provide customers with complete services ranging from laboratory tests to pilot scale amplification and industrial production.

  Our company is committed to the sustainable development and long-term success, to steadily enhance the value of the enterprise, to stick to the "integrity and win-win" spirit of enterprise, to establish a good corporate image, to provide high-quality, high value products for new and old customers at home and abroad wholeheartedly.

 At present, our products focus on inorganic raw materials, most of which are lithium salts. We look forward to working with you sincerely and jointly create a promising future!

Details

Product Name: Glucagon
Synonyms: GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
CAS: 16941-32-5
MF: C153H225N43O49S
MW: 3482.75
EINECS: 685-611-6
Product Categories: Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research;16941-32-5
Mol File: 16941-32-5.mol
Glucagon Structure

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog