lower price High quality LL-37 CAS NO.154947-66-7
- FOB Price: USD: 1.00-1.00 /Kilogram Get Latest Price
- Min.Order: 1 Kilogram
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Available Specifications:
Industrial Grade (1-10)Kilogram
- Product Details
Keywords
- LL-37
- 154947-66-7
- LL-37
Quick Details
- ProName: lower price High quality LL-37
- CasNo: 154947-66-7
- Molecular Formula: C205H340N60O53
- Appearance: white or almost white powder
- Application: For scientific research
- DeliveryTime: Per request
- PackAge: 1kg/drum, 25kg/drum, 200kg/drum,500kg/...
- Port: Shanghai
- ProductionCapacity: 100 Metric Ton/Month
- Purity: 99%min
- Storage: Keep it in dry, cool and ventilated pl...
- Transportation: by sea or by air
- LimitNum: 1 Kilogram
Superiority
Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceutical, chemical, food, health care, cosmetics and other fields. Customers are now in Asia, Europe, America and other countries and regions.
Company adheres to market-oriented, technology as the core, customer-centric. R & D headquarters is located in Suzhou, and the core members of R & D team consist of senior postdoctoral fellows and docteral students and masters who are rich in experience. The two factories, respectively located in Shandong and Henan, provide customers with complete services ranging from laboratory tests to pilot scale amplification and industrial production.
Our company is committed to the sustainable development and long-term success, to steadily enhance the value of the enterprise, to stick to the "integrity and win-win" spirit of enterprise, to establish a good corporate image, to provide high-quality, high value products for new and old customers at home and abroad wholeheartedly.
At present, our products focus on inorganic raw materials, most of which are lithium salts. We look forward to working with you sincerely and jointly create a promising future!
Details
Product Name: | LL-37 |
Synonyms: | Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate |
CAS: | 154947-66-7 |
MF: |
C205H340N60O53 |
EINECS: | 211-519-9 |