Product Certification&
    Enterprise Certification

  • Mr.Julian
    Tel: +86 156 1855 4368

  • Mobile:156 1855 4368
  • Tel:+86 156 1855 4368
  • Fax:+86-021-6711 7095
  • Province/state:Shanghai
  • City:Shanghai
  • Street:No.12, Lane 356, Chengnan Road, Chuansha Town, Shanghai
  • MaxCard:
Home > Products >  Calcitonin eel

Calcitonin eel CAS NO.57014-02-5

  • FOB Price: USD: 1.00-1.00 /Kilogram Get Latest Price
  • Min.Order: 1 Kilogram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Available Specifications:

    Industrial Grade (1-10)Kilogram

  • Product Details

Keywords

  • Calcitonin eel
  • 57014-02-5
  • Calcitonin eel

Quick Details

  • ProName: Calcitonin eel
  • CasNo: 57014-02-5
  • Molecular Formula: C146H241N43O47S2
  • Appearance: white or almost white powder
  • Application: For scientific research
  • DeliveryTime: Per request
  • PackAge: 1kg/drum, 25kg/drum, 200kg/drum,500kg/...
  • Port: Shanghai
  • ProductionCapacity: 100 Metric Ton/Month
  • Purity: 99%min
  • Storage: Keep it in dry, cool and ventilated pl...
  • Transportation: by sea or by air
  • LimitNum: 1 Kilogram
  • Grade: Industrial Grade

Superiority

Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceutical, chemical, food, health care, cosmetics and other fields. Customers are now in Asia, Europe, America and other countries and regions.

  Company adheres to market-oriented, technology as the core, customer-centric. R & D headquarters is located in Suzhou, and the core members of R & D team consist of senior postdoctoral fellows and docteral students and masters who are rich in experience. The two factories, respectively located in Shandong and Henan, provide customers with complete services ranging from laboratory tests to pilot scale amplification and industrial production.

  Our company is committed to the sustainable development and long-term success, to steadily enhance the value of the enterprise, to stick to the "integrity and win-win" spirit of enterprise, to establish a good corporate image, to provide high-quality, high value products for new and old customers at home and abroad wholeheartedly.

 At present, our products focus on inorganic raw materials, most of which are lithium salts. We look forward to working with you sincerely and jointly create a promising future!

Details

Product Name: Calcitonin eel
Synonyms: THYROCALCITONIN EEL;CALCITONIN, EEL;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7);H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7);cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1-7];miacalcic
CAS: 57014-02-5
MF: C146H241N43O47S2
MW: 3414.91
EINECS: 232-693-2
Product Categories: Peptide;TPI
Mol File: 57014-02-5.mol
Calcitonin eel Structure

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog